Transcript | Ll_transcript_209152 |
---|---|
CDS coordinates | 2-808 (-) |
Peptide sequence | MIKFNSFPLIKTNLSLLLSHHAITITTLTLSNLKQQTYTSKQRVSEQTCLSLLHSCTTLTSLTQIHSLILKLGLHQNPLVLTKFASTSSNFNSIHYASSFIFPSYPNAHNANPPLFHDAFLFNTVIRAYAQTLHSKSMALHFYKTMLCYGVLPNKFTYPFVLKACAGIGGLNLGKSVHGFVVKLGFEDDLHVQNTMIHMYCCCEGEVEFARKVFEGSPKSDSVTWSAMIGGYARSGRSAEAVGLFREMQVVGVCPDEITMVSVLSACTD |
ORF Type | 3prime_partial |
Blastp | Putative pentatricopeptide repeat-containing protein At3g05240 from Arabidopsis with 38.01% of identity |
---|---|
Blastx | Putative pentatricopeptide repeat-containing protein At3g05240 from Arabidopsis with 37.68% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT3G05240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447541.1) |
Pfam | PPR repeat (PF12854.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer