Protein coding transcript 130140

• Transcript: Ll_transcript_209158
• CDS coordinates: 1-306 (-)
• Peptide sequence: SKAPHKKSPATPKTVRQLETPNSDSSPHSARKTPKDRSPKVNEQKSPQSPMVEKKRPTKKIKELESQIAQLQEDLKRAKDQLNSSESWKKKAQQEEKKKKKQ
• ORF Type: internal

Annotations of Ll_transcript_209158

• Blastp: Interactor of constitutive active ROPs 2, chloroplastic from Arabidopsis with 52.83% of identity
• Blastx: Interactor of constitutive active ROPs 2, chloroplastic from Arabidopsis with 55.17% of identity
• Eggnog: interactor of constitutive active rops(ENOG410YE21)
• Kegg: Link to kegg annotations (AT2G37080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003520644.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;