Protein coding transcript 130141

• Transcript: Ll_transcript_209157
• CDS coordinates: 123-632 (+)
• Peptide sequence: MKRQRDFEVLESIDLANCLMLLTHPQQQSKFSDPVEFECKTCNRKFSSFQALGGHMTSHKRPKLESEETIAQAKTLTLSLGNKPKFHKCTICGQEFSIGQALGGHMKRHRGSINEDISSIKKVAVAKVAPVLKRSNSIRVTWLDLNFTPLENDLNILFGKMTPKVHAFL*
• ORF Type: complete

Annotations of Ll_transcript_209157

• Blastp: Zinc finger protein ZAT11 from Arabidopsis with 50% of identity
• Blastx: Zinc finger protein ZAT11 from Arabidopsis with 50% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT2G37430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425072.1)
• Pfam: C2H2 type zinc-finger (2 copies) (PF12756.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;