Protein coding transcript 130142

• Transcript: Ll_transcript_209163
• CDS coordinates: 34-861 (+)
• Peptide sequence: MCDALKNSYELFEEIGRGKFGTVFRCYNPTTNKSHAAKIIHKHLLVDSTDRMCLENESKIMTYLSPHPNILQISDVFEDNESLSIVTELCQPNFTLLDRITNHPLSELEAASMMENLLEAVSYCHKLGIAHRDIKPENILFDSWGNLKVCDFGSAEWFGDGRNMNGIVGTPYYVAPEVLLGREYNEKVDVWSSGVIMYIMLSGIPPFYGDSAAQIFEAVTRGNLRFPTKIFKNVSPSAKDLMRKMISRDPSRRISAEQALRHPWILSGGLTSDLA*
• ORF Type: complete

Annotations of Ll_transcript_209163

• Blastp: Phosphoenolpyruvate carboxylase kinase 1 from Arabidopsis with 55.76% of identity
• Blastx: Phosphoenolpyruvate carboxylase kinase 1 from Arabidopsis with 54.51% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT1G08650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417880.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;