| Transcript | Ll_transcript_209156 |
|---|---|
| CDS coordinates | 3-338 (+) |
| Peptide sequence | ILCAQHLETRFVKLNVTRFPFLTERMKIRVIPTIVSIVDSISKDFIVGFTELGNCDDFSTEMLEWRLARSQVIDYKGDLINPPDVVKNNRTMLLEKNKTIRGYIGNDSDGLD |
| ORF Type | internal |
| Blastp | Thioredoxin domain-containing protein 9 from Mus with 52.83% of identity |
|---|---|
| Blastx | Thioredoxin domain-containing protein 9 from Mus with 52.83% of identity |
| Eggnog | Thioredoxin(COG0526) |
| Kegg | Link to kegg annotations (98258) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003536596.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer