Protein coding transcript 130147

• Transcript: Ll_transcript_161097
• CDS coordinates: 2-418 (+)
• Peptide sequence: FFNTEVIFDKNGQIIAKHRKINLNDEEKKVLTPGSNATVVEINGNRFRVLINEDLFSPLANFLNGTNNLAGYIVSMSWKNQFPFEIATSIQAGFAISNEIPVIAANLNAPSVGISGSGVYHYENSLTKSCSITGKSGIS
• ORF Type: internal

Annotations of Ll_transcript_161097

• Blastp: Vanin-like protein 2 from Sophophora with 33.88% of identity
• Blastx: Vanin-like protein 2 from Sophophora with 33.88% of identity
• Eggnog: nitrilase cyanide hydratase and apolipoprotein n-acyltransferase(COG0388)
• Kegg: Link to kegg annotations (Dmel_CG32751)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020208522.1)
• Pfam: Carbon-nitrogen hydrolase (PF00795.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;