Protein coding transcript 130148

• Transcript: Ll_transcript_161088
• CDS coordinates: 2-310 (+)
• Peptide sequence: SITAQSTFNDLQDLREQILRVKDTDDVLMGLVGNKCDLEEERVVGKEQGTNLARQFNCAFMETSAKAKINVYEVFFDLVRQINKKSPDNPPKKKKNPSCVLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_161088

• Blastp: Ras-related protein Rap-1b from Rattus with 78.64% of identity
• Blastx: Ras-like protein 3 from Sophophora with 82.35% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (171337)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007161390.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;