Protein coding transcript 130153

• Transcript: Ll_transcript_264983
• CDS coordinates: 90-722 (+)
• Peptide sequence: MNLPKFSSGEGTSSPSPKKEIQIQGPRPPALRVSKESHKISKPPLPPPAAHYPLPPEHRQPLIIYSVSPKIVHVTVNDFKNTVQRLTGPSSGDDPALRSGDVSPAARLASIEKTSPSEKERGHGGGDDDMMWLLEGVEMGQFPGILSPATLPPISSGFFSPVTELHQTSSFWNDLSPFWSTNTFVASPSGLLSAAVVSPLPSPDLFNLFD*
• ORF Type: complete

Annotations of Ll_transcript_264983

• Blastp: Protein MKS1 from Arabidopsis with 42.99% of identity
• Blastx: Protein MKS1 from Arabidopsis with 43.5% of identity
• Eggnog: VQ domain containing protein(ENOG410YNID)
• Kegg: Link to kegg annotations (AT3G18690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462901.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;