Protein coding transcript 130158

• Transcript: Ll_transcript_260744
• CDS coordinates: 175-1035 (+)
• Peptide sequence: MIMDFPIIDNLKYWLLDHPSIVGFRWSPTQSWGSTWPFLVTGIMTYILTAITLHRILKILKCHRPVPLGPIPALHSLSMSIISITIFIAMLFSATAEIHDTWWLWRRTRTTSLEWFLCFPLGIRPSGRVFFWSYVFYLSRLLHFLRTFFTILRHRKLSFFRLFNHSILFITSFLWLEFSQSFQVLAILLSTFVYTLVYGHRLWMELGLPSKCFSFTVNCQMLLLCCNLVCHVGVLLLHFLRGGCNGIGAWVFNSGLNAVILLLFLKFYANMHCQRKNTTCQAYYLS*
• ORF Type: complete

Annotations of Ll_transcript_260744

• Blastp: Elongation of fatty acids protein 3-like from Arabidopsis with 59.21% of identity
• Blastx: Elongation of fatty acids protein 3-like from Arabidopsis with 59.71% of identity
• Eggnog: elongation of very long chain fatty acids protein(ENOG410XRWT)
• Kegg: Link to kegg annotations (AT4G36830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004499120.1)
• Pfam: GNS1/SUR4 family (PF01151.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;