Protein coding transcript 130164

• Transcript: Ll_transcript_41280
• CDS coordinates: 1-456 (+)
• Peptide sequence: KKASAKPKGGASKKAHEAAKAALKGVHGNKKRKIRRSTSFHRPKTLELSRAGKYPRKSVPHAPRMDAEKVLIHPLNTESAMKKIEENNTLVFICNVKANKRQIAAALKKQYDVSCVKINTLIRPDGSKKAFCRLTADVDALDIAATKLAIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_41280

• Blastp: 60S ribosomal protein L25 from Puccinia with 69.17% of identity
• Blastx: 60S ribosomal protein L25 from Puccinia with 71.93% of identity
• Eggnog: One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome (By similarity)(COG0089)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014494213.1)
• Pfam: Ribosomal protein L23, N-terminal domain (PF03939.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;