| Transcript | Ll_transcript_41283 |
|---|---|
| CDS coordinates | 3-302 (+) |
| Peptide sequence | EVLNKRLAEMMALLTCQKNSTKGKCLKFNASAELKQILARMDTRVYKLYMSLPTNAMLIICTGHGDTAIVRRLRKMLAEENESNLCRGHIIEILEEVQAR |
| ORF Type | internal |
| Blastp | Small RNA degrading nuclease 5 from Arabidopsis with 55.1% of identity |
|---|---|
| Blastx | Small RNA degrading nuclease 5 from Arabidopsis with 55.1% of identity |
| Eggnog | DNA polymerase iii(COG0847) |
| Kegg | Link to kegg annotations (AT5G25800) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003544731.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer