Protein coding transcript 130167

• Transcript: Ll_transcript_41286
• CDS coordinates: 3-536 (+)
• Peptide sequence: IYKQQTSMLKKLQIKSQKLDKKWKSLKTLRRVSNAICVAAFVSVLIISVVVAAVAAPPVVANLVGALSAPIDSVGKWCNSLFTKFETAVKGQREVISSMEFGACIALKDLTNIRLSTGKLEIEIKSLVQNAEFALENEDAVRLVIDEIKKKIDTFAEIIESLSEQAAKCSGMIRTART
• ORF Type: internal

Annotations of Ll_transcript_41286

• Blastp: UPF0496 protein At2g18630 from Arabidopsis with 55.06% of identity
• Blastx: UPF0496 protein At2g18630 from Arabidopsis with 55.06% of identity
• Eggnog: UPF0496 protein(ENOG4111ATG)
• Kegg: Link to kegg annotations (AT2G18630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003611921.1)
• Pfam: Protein of unknown function (DUF677) (PF05055.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;