Protein coding transcript 130168

• Transcript: Ll_transcript_229953
• CDS coordinates: 3-335 (+)
• Peptide sequence: KIHYMAPNMYCCGAGTAADTEFTTAAISSQLELHRLNTGRVVPVVTANMMLRQMLFRYQGHIGAALILGGVDNSGPHLYNIYPHGSSDNLPYCTMGSGSLGAMAVFESRWK
• ORF Type: internal

Annotations of Ll_transcript_229953

• Blastp: Proteasome subunit beta type-7 from Sus with 73.87% of identity
• Blastx: Proteasome subunit beta type-7 from Sus with 73.87% of identity
• Eggnog: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)(COG0638)
• Kegg: Link to kegg annotations (100037992)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453171.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;