Protein coding transcript 130171

• Transcript: Ll_transcript_175103
• CDS coordinates: 1-345 (+)
• Peptide sequence: MMATLESMLTSSGFVGREFSSLGKTYKVKVGDNFSYVDPIDKSVAKNQGLRVLFEDGSRLVFRLSGTGSSGATVRLYVDSYEQSNFKNDAQDILKPLVNIALEMSQLQKFTGRDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_175103

• Blastp: Phosphoglucomutase from Sophophora with 67.83% of identity
• Blastx: Phosphoglucomutase from Sophophora with 67.83% of identity
• Eggnog: phosphoglucomutase(COG0033)
• Kegg: Link to kegg annotations (Dmel_CG5165)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014507049.1)
• Pfam: Phosphoglucomutase/phosphomannomutase, C-terminal domain (PF00408.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;