Protein coding transcript 130177

• Transcript: Ll_transcript_173284
• CDS coordinates: 2-730 (+)
• Peptide sequence: PILYAAWAEAGLFPVSDLTNLRKIDSDLEGHPTPRLNFIDVGTGSLGQGLSVACGMAYVGKYFDKSSYRTFCLLGDGESAEGSVWEALNFASVYNLDNLVVIFDINRLGQSGPTPLQHDMEVYRQRVTAFGLNAIVVDGHDIEELTKAFHEASITKGKPTAILAKTFKGKGFINIEDAEKWHGTPLNDKTVKVLEEINGQIRNKKMPVNIPKPIADVPAINITNVHLSSPPNYTLGEKIATRV
• ORF Type: internal

Annotations of Ll_transcript_173284

• Blastp: Transketolase from Bos with 61.73% of identity
• Blastx: Transketolase from Bos with 61.73% of identity
• Eggnog: Transketolase(COG0021)
• Kegg: Link to kegg annotations (445425)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003605141.1)
• Pfam: Transketolase, thiamine diphosphate binding domain (PF00456.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;