Protein coding transcript 130178

• Transcript: Ll_transcript_173278
• CDS coordinates: 3-551 (+)
• Peptide sequence: LVDLYDYFLVESKIAGKVVRKCGKIFYKKRKVPNPIKLWCTQLKKHIDASLLKTQFNVTGHGDSYTIQFGHSDMDTKDLVENVFSLIEGLDKQFPGGFNNIKLMQIFTQHATPIPIYLDTKDPNEVQVPVLKPNKINTPKRVRGELSTVTNADVIVSREGNVKVIKNDDEKGNPDEITIDDLL
• ORF Type: internal

Annotations of Ll_transcript_173278

• Blastp: Ribosomal L1 domain-containing protein 1 from Mus with 26.17% of identity
• Blastx: Ribosomal L1 domain-containing protein 1 from Mus with 26.17% of identity
• Eggnog: Ribosomal L1 domain containing 1(ENOG4111W39)
• Kegg: Link to kegg annotations (66409)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003545905.1)
• Pfam: Ribosomal protein L1p/L10e family (PF00687.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;