Protein coding transcript 130182

• Transcript: Ll_transcript_243522
• CDS coordinates: 1-540 (+)
• Peptide sequence: QNQNFLPASVRDGRSSFGQKIVLNYMMVSPKAVIGICAGVSATLFLGYCIYFDVQRHKDPDFKKKLRQRRRAKKQTCHKRPHTVFPDMKDHEAVQQFFLQEIQLGEELLAAGDLESGVDHLGNAVAVCGQPNDLLQVLQQTLQPQVFHLLIQRLPSVAPRLMKAQPAPNSSSLQEEDVE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_243522

• Blastp: Mitochondrial import receptor subunit TOM20 homolog from Rattus with 57.93% of identity
• Blastx: Mitochondrial import receptor subunit TOM20 homolog B from Danio with 60.77% of identity
• Eggnog: Translocase of outer mitochondrial membrane 20 homolog(ENOG4111NAH)
• Kegg: Link to kegg annotations (266601)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014512745.1)
• Pfam: MAS20 protein import receptor (PF02064.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;