Protein coding transcript 130183

• Transcript: Ll_transcript_243500
• CDS coordinates: 1-357 (+)
• Peptide sequence: SSWRLSRSVGDVSKFSTTLIRCASSNLPSDKVTHTGQKWEDDDYRMARFVGKTKIVNENWAAKLIDSVPPETRKERVVSCDGGGGPTGHPKVYINLDKPGNHSCLYCGLRFHKDDSHH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_243500

• Blastp: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial from Pongo with 47.06% of identity
• Blastx: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial from Pongo with 47.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187822.1)
• Pfam: Zinc-finger domain (PF10276.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;