Protein coding transcript 130184

• Transcript: Ll_transcript_243491
• CDS coordinates: 20-334 (+)
• Peptide sequence: MHRARTVVNQIVGPPGQKFAGWLLAKNTPSINVCASIRNYNVPVTSEPFLNGSSSQYVEDMYNAWLADPNSVHSSWDSFFRNSAQGGAGYQAPPSLAPLGKNEVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_243491

• Blastp: 2-oxoglutarate dehydrogenase, mitochondrial from Bos with 58.46% of identity
• Blastx: 2-oxoglutarate dehydrogenase, mitochondrial from Bos with 50.63% of identity
• Eggnog: 2-oxoglutarate dehydrogenase, E1(COG0567)
• Kegg: Link to kegg annotations (534599)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016194656.1)
• Pfam: 2-oxoglutarate dehydrogenase N-terminus (PF16078.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;