Protein coding transcript 130186

• Transcript: Ll_transcript_243518
• CDS coordinates: 3-1136 (-)
• Peptide sequence: MAPTISCTIISLLLLLLLSFLISQTHSQQQYVNNKQLKCEDTTNSTYGNICNSNPSCQSYLTFISSSPFYNTPSSISYLLNSKPSLIAQSNNITDVDPIPTNTLITIPVNCSCFNNLYQHNTTYTLKTLGETYFSIANNTYEALTTCQALMAQNIYEATNLTAGLNLHVPLRCACPTKKQLDEGFKYLLTYLVSEGDSVASIAEIFGVDQQSVWDANDLSPGSIIFFFTPLLVPLKQEPPAKLQILTPSPQPQPPPQPPSPEGGGGSSSSSKKWVIVGVAIGVVVLLVVLLVFLFCFYRRRREPPLPVVESAKILSDSTTTEGTKKVSETTSTSETWSLSSEGIHYAIESLTLYKFEELEKATGSFSEENRIKGSVYR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_243518

• Blastp: Protein LYK5 from Arabidopsis with 47.87% of identity
• Blastx: Protein LYK5 from Arabidopsis with 47.93% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G33580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434061.1)
• Pfam: LysM domain (PF01476.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;