Protein coding transcript 130188

• Transcript: Ll_transcript_243517
• CDS coordinates: 3-452 (+)
• Peptide sequence: QLFFTITQNPMVLSLATIIMRLLPLPIFLCLLLKQMSLVLGDVGTASSYGPPYIPTVCDGNRVEQFPPGNMFVAVSEGLWDNGAACGRRYKLRCLSGNKRPCKGGSIDVTVVDFCPRSPCPNTFLMSHDAFEAISRFRNAKIIIEYTQI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_243517

• Blastp: EG45-like domain containing protein from Citrus with 35.11% of identity
• Blastx: EG45-like domain containing protein from Citrus with 37.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002134)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416738.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;