Protein coding transcript 130189

• Transcript: Ll_transcript_243509
• CDS coordinates: 193-723 (+)
• Peptide sequence: MEEVQKVKDEAMQMMGLFQVLPRLVVFDLDYTLWPFYCECRSKRDTPSLFPHSRGILHALKDKGIDAAIASKSPTPDIAKTFLHKLSITSMFVSQEIFYTGTHKTDHFQKIHVKTGVPYNSMLFFDDDNNNIQGVSEMGVTSILVRKGVTLGAFREGLTKFYQNWNASKGKGKRHT*
• ORF Type: complete

Annotations of Ll_transcript_243509

• Blastp: Magnesium-dependent phosphatase 1 from Mus with 37.82% of identity
• Blastx: Magnesium-dependent phosphatase 1 from Mus with 37.82% of identity
• Eggnog: Magnesium-dependent phosphatase(ENOG4111PHW)
• Kegg: Link to kegg annotations (67881)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424572.1)
• Pfam: Acid Phosphatase (PF12689.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;