Protein coding transcript 130193

• Transcript: Ll_transcript_151297
• CDS coordinates: 40-543 (+)
• Peptide sequence: MAYQGANGDTKAAFASTLGVPDNKLAANGYSKIMDRLNSVENVTLLMANKVFLKSGLALQEEFGKTAKEDFKSEVQQVDFAKNVAAAQTINSWVEDKTKNKIKDLITPDSLDGMTRLVLVNAIYFKGDWLSKFDKANTRKMPFYTSETVKSDVDMMFRQGEYNYKFDR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_151297

• Blastp: Serine protease inhibitor 3/4 from Lonomia with 45.22% of identity
• Blastx: Serine protease inhibitor 3/4 from Lonomia with 42.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013455531.1)
• Pfam: Serpin (serine protease inhibitor) (PF00079.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;