Transcript | Ll_transcript_151315 |
---|---|
CDS coordinates | 2-721 (+) |
Peptide sequence | FFLFDPVSASVLFTFFKNRNFLYFLRLFFTNNRPNTVMSAGVMCYRCNRSGHFARDCRDSGSVSSATFSRGGRGGGERGGIGGGSSDRETNCYKCNRSGHIARDCKDKDRCYRCDGVGHIARDCSQSASEPSCYNCRKTGHLARECPDERADRGSGGGMGGGGMGGGGSSSTCYNCNKIGHFSRDCMESRNGGSGNYSALCRNCNGSGHMARDCPEGNKQSCYNCGEQGHLSRECRKRN* |
ORF Type | 5prime_partial |
Blastp | CCHC-type zinc finger protein CG3800 from Sophophora with 41.76% of identity |
---|---|
Blastx | DNA-binding protein HEXBP from Leishmania with 32.44% of identity |
Eggnog | zinc finger(COG5082) |
Kegg | Link to kegg annotations (Dmel_CG3800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020963505.1) |
Pfam | Zinc knuckle (PF14392.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer