Protein coding transcript 130196

• Transcript: Ll_transcript_151307
• CDS coordinates: 2-523 (+)
• Peptide sequence: EVNGIEGNGITDNPFMSVIGMPWFGMDIGGTLCKLVYFEPKDISKNKNDAEVEQTLRNIRRYLTKNSAYGNTGHRDIHLQMDNVSIRGILGTLHFIRFPTSEMKNFLVLAKYKGMAKLVSTVCATGGGAYKFEEDFKREVNMKLAKFDEFESLLKGLQYIDARSPTECYYWANP
• ORF Type: internal

Annotations of Ll_transcript_151307

• Blastp: Pantothenate kinase 1 from Mus with 52.56% of identity
• Blastx: Pantothenate kinase 1 from Mus with 52.56% of identity
• Eggnog: PaNtothenate Kinase(COG5146)
• Kegg: Link to kegg annotations (75735)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014490606.1)
• Pfam: Fumble (PF03630.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;