| Transcript | Ll_transcript_151321 |
|---|---|
| CDS coordinates | 371-730 (-) |
| Peptide sequence | FVALFIVSNQQRCFIKGRHIKDCICTASEATNLLDSKTCGGNLAIKLDVRKAFDTLDWNLLLNTLKAFGSDDKFVNWIEVILRSAMLSISVNGQRVGFFSCKRGVRQGDPLSSLLFLSC* |
| ORF Type | 5prime_partial |
| Blastp | Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 from Popillia with 40.28% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427157.1) |
| Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer