Protein coding transcript 130199

• Transcript: Ll_transcript_151324
• CDS coordinates: 1-336 (+)
• Peptide sequence: KGKEIVEVKPQWVTKGSVTQEVLSALTRAGKSPDFVLCIGDDRSDEDMFESILTKAYGATSSTSPEMFACTVGQKPSKARYYVDDTMEANMILQGLSAISAIMIRSAAASV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_151324

• Blastp: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 from Arabidopsis with 55.45% of identity
• Blastx: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 from Arabidopsis with 57.29% of identity
• Eggnog: synthase(COG0380)
• Kegg: Link to kegg annotations (AT1G60140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430358.1)
• Pfam: Trehalose-phosphatase (PF02358.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;