Protein coding transcript 130201

• Transcript: Ll_transcript_151314
• CDS coordinates: 210-626 (+)
• Peptide sequence: MDDIFDSSLNLEETHFKEGYDEGYTHGLISGKEDATQVGLKVGFEIGEELGFYRGCVDIWTSVIRVDPTQFSQRAKTGITQMEELLHKYPLMDPENSQVQEIMDSLRIKFKMVCYSLHVKLEYNGYPKSSAEANDIQF*
• ORF Type: complete

Annotations of Ll_transcript_151314

• Blastp: Oral cancer-overexpressed protein 1 homolog from Mus with 30.53% of identity
• Blastx: Oral cancer-overexpressed protein 1 homolog from Mus with 30.53% of identity
• Eggnog: Essential protein Yae1, N terminal(ENOG4111U8U)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451297.1)
• Pfam: Essential protein Yae1, N terminal (PF09811.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;