Protein coding transcript 130202

• Transcript: Ll_transcript_151330
• CDS coordinates: 109-597 (+)
• Peptide sequence: MSITNIIILISAVFLLVPPPLAATSSAPTAYELLEQYNFPGGILPKGITGYEIDESTGKFRAYLNGTCSFSLEGSYQLSYKSIFSGRISKNRLTDLNGVSVKVLFFWLNIVEVVRDGDNLDFSVGIASASFPLDNFFVSPQCGCGLVCDDEFENPSLPLSSM*
• ORF Type: complete

Annotations of Ll_transcript_151330

• Blastp: Uncharacterized protein At5g01610 from Arabidopsis with 30.61% of identity
• Blastx: Uncharacterized protein At5g01610 from Arabidopsis with 30.61% of identity
• Eggnog: Protein of unknown function, DUF538(ENOG4110611)
• Kegg: Link to kegg annotations (AT5G01610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431241.1)
• Pfam: Protein of unknown function, DUF538 (PF04398.11)
• Rfam: -
• GO: -