Protein coding transcript 130205

• Transcript: Ll_transcript_151300
• CDS coordinates: 3-389 (+)
• Peptide sequence: VMEEYQKEMKKLSGKLMELMLESLGLTLEDVEWFKPKNGTDRAQSMLQLNSYPTCPDPDRAMGLAPHTDSSILTILHQSISGGLQIHEDGIGWIPVHSVPGSLVVNVGDFLHILSNGQYKSPYHRAIVN
• ORF Type: internal

Annotations of Ll_transcript_151300

• Blastp: Gibberellin 3-beta-dioxygenase 1 from Arabidopsis with 58.91% of identity
• Blastx: Gibberellin 3-beta-dioxygenase 1 from Arabidopsis with 58.91% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT1G15550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462717.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;