Protein coding transcript 130206

• Transcript: Ll_transcript_151313
• CDS coordinates: 3-539 (+)
• Peptide sequence: EQQDVNLLKMEHLKPEYLKINPQHTVPSLDDNGFILWDSHAIMTYLINKYGKDDSLYPKEAQARGLIDQRLFFDAGTLFPRMLVITKSIIFQGAKSIPKEQSDAVIEAYGYVENYLENTKFVAGNNVTIADFSLVTTATSCDLVVPIDATKFPKIAAWIKKMEQLPYYNVNKVGLDMLR
• ORF Type: internal

Annotations of Ll_transcript_151313

• Blastp: Glutathione S-transferase 1 from Manduca with 43.65% of identity
• Blastx: Glutathione S-transferase 1 from Manduca with 43.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015938938.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;