Protein coding transcript 130207

• Transcript: Ll_transcript_161338
• CDS coordinates: 35-439 (+)
• Peptide sequence: MADSQVTLRTRKFIRNPLLGRRQMVVDVLHPNRANVSKDELRGKLGELYKAKKDDVSVFGFKTHFGGGKSTGFALIYDSAEAMKKFEPRYRLVRYGMATKVEKASRQQRKQRKNRMKEFRGTAKSKGGAKKDKK*
• ORF Type: complete

Annotations of Ll_transcript_161338

• Blastp: 40S ribosomal protein S24 from Chaetomium with 77.69% of identity
• Blastx: 40S ribosomal protein S24 from Chaetomium with 77.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CTHT_0041970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001238140.1)
• Pfam: Ribosomal protein S24e (PF01282.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;