Protein coding transcript 130210

• Transcript: Ll_transcript_161313
• CDS coordinates: 1-381 (+)
• Peptide sequence: GKQNSPSSAHQASTPAALPEHLAEDGKANRMMKLMGWGGGGLGKEQQGRQTPVQVEQRVGRIGLGANVNVNSPQFRNYILGILRKYHDSCDDHDLVFASDYSKEERAQIHVLARRFQRGLKTASHGA
• ORF Type: internal

Annotations of Ll_transcript_161313

• Blastp: NF-kappa-B-repressing factor from Mus with 38.79% of identity
• Blastx: NF-kappa-B-repressing factor from Mus with 38.79% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (77286)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006600435.1)
• Pfam: G-patch domain (PF12656.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;