| Transcript | Ll_transcript_40315 |
|---|---|
| CDS coordinates | 2-328 (+) |
| Peptide sequence | FKPASVDVSKMASVAVEMNQQVTVTVPHLDGAGTEHTVFKGSQRPYHKECVLIIDRRTGEVMLEKLSSNIQVKKTRKETNKATPGAPGRPNQPGLPSLLDNSPPEQLAS |
| ORF Type | internal |
| Blastp | Ell-associated factor Eaf from Sophophora with 57.3% of identity |
|---|---|
| Blastx | Ell-associated factor Eaf from Sophophora with 57.3% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (Dsec_GM20800) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003630983.1) |
| Pfam | RNA polymerase II transcription elongation factor (PF09816.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer