Transcript | Ll_transcript_40321 |
---|---|
CDS coordinates | 47-337 (+) |
Peptide sequence | MVLRPEDYLLPLPMLGGEKWCIGFQKAQDQTILGDIILKDKIIVYDLAKQRIGWTYHNCSLPFNVSTRSSGKSITEKGGTLHLTMIVVLVFFMHLI* |
ORF Type | complete |
Blastp | Aspartic proteinase-like protein 2 from Arabidopsis with 34.62% of identity |
---|---|
Blastx | - |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AT1G65240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452717.1) |
Pfam | Xylanase inhibitor C-terminal (PF14541.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer