Transcript | Ll_transcript_40350 |
---|---|
CDS coordinates | 194-727 (-) |
Peptide sequence | GEKDNGHEGSRQESGSSSSQRVSVNDQALKRNKKKLDKKKIQCFRCKIFGHYASECISRFVNSGADVEARLAQENESDEDQVLLMVTTEQINTKDDCWYLDTGCSNHMTGHKDWFVSLDETTKSKVKFADHTCIEAERIGDISIQRRDGKHPCIQNVLYVPKMRSNLLSLGQLLEKG* |
ORF Type | 5prime_partial |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 26.29% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447306.1) |
Pfam | Zinc knuckle (PF00098.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer