Protein coding transcript 130220

• Transcript: Ll_transcript_40319
• CDS coordinates: 2-487 (+)
• Peptide sequence: AKLLHDAWNLAYAGDLSFATALNMTLFLKYEREYLAWDPVFTLIDHIGRHIDSSAVHKKFQSYVRILLTPLYEELGNDPQEGESEGRAHLRSSSKVFLCQAGYKPCIKEAQEAFKKWMEIDNPDEGNPVANQYICPVFKWGTQEEWEFGLQRVIQFPPGRKQ
• ORF Type: internal

Annotations of Ll_transcript_40319

• Blastp: Aminopeptidase N from Rattus with 27.33% of identity
• Blastx: Aminopeptidase N from Rattus with 27.33% of identity
• Eggnog: aminopeptidase(COG0308)
• Kegg: Link to kegg annotations (81641)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004501449.1)
• Pfam: ERAP1-like C-terminal domain (PF11838.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;