Protein coding transcript 130221

• Transcript: Ll_transcript_40320
• CDS coordinates: 1-480 (+)
• Peptide sequence: KQNERTYLLKTLAGCPNDASKIERLLNITVLEKNGNFTDTDVYLIFSMLTGGANGYTTLFNFLKKNWDEIKLRLEDRPHLWNSLITSATSVFKTQEGLDMVSELYVQRQSEFGTADFVIEKSLKNIKEETKWSNDNLPIIEKWLDNYLAVNDVQTTTKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_40320

• Blastp: Aminopeptidase 2, mitochondrial from Saccharomyces with 25.23% of identity
• Blastx: Aminopeptidase 2, mitochondrial from Saccharomyces with 25.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YKL157W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: ERAP1-like C-terminal domain (PF11838.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;