Protein coding transcript 130224

• Transcript: Ll_transcript_40322
• CDS coordinates: 2-592 (+)
• Peptide sequence: AMSSTEPKAYEIMTSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTERGEFRIDSQGSPTMLNCLMYKLSYYRFGDLKLDFRTPAGFDRTRNAVIGNQNFDLTYLEEAYTTEHWLVRIYRVKKPDEFNRPRIPVLERKIRNPGASAISKKSARKKKGIIQGKPTVLKGKKPKATNTYTNGI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_40322

• Blastp: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B from Canis with 69.06% of identity
• Blastx: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B from Canis with 75.5% of identity
• Eggnog: oligosaccharyl transferase STT3 subunit(COG1287)
• Kegg: Link to kegg annotations (485628)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015966210.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;