Protein coding transcript 130233

• Transcript: Ll_transcript_41311
• CDS coordinates: 118-1197 (+)
• Peptide sequence: MEQNNVIAPFVMKTYHMVNDPITDNLITWGPTNNSFIVLDPLEFSQSLLPAFFKHNNFSSFVRQLNTYGFKKVDPDRWEFANEWFLRGQKHMLKNIVRRKHCSRSYNSKFSSLSSSNSHLGKFEELSDEDMVMEITRLKEEQKALDEELQEMNKRLETTEKRPQQMMTFLCKVVEDPDVLSRTLIERERKQVAEKKRRLLSAATSSSSSSGMAMKTDFEEEETTLGNTILSSSLETGFEIDNFYHMAASPTHEAVAGGDAVAVWWRQKQGMVIGLPTRIAHDEYNYNDVYTYNYNDDNYNCTAAPIPLMAATNSSPPLSESYFRHDNNNSKKHVEIFSEMAAGSSPRPPYPFSLLEGGF*
• ORF Type: complete

Annotations of Ll_transcript_41311

• Blastp: Heat stress transcription factor C-1 from Arabidopsis with 61.65% of identity
• Blastx: Heat stress transcription factor C-1 from Arabidopsis with 63.45% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (AT3G24520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457271.1)
• Pfam: HSF-type DNA-binding (PF00447.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;