Protein coding transcript 130235

• Transcript: Ll_transcript_41312
• CDS coordinates: 21-635 (+)
• Peptide sequence: MESNGYEEFHRYLHYHSPTEKPIPTSNFMNMGTGIGHEEGHDLTPLDPSHGLHHMLLHYSQLHLPSNTNSPIKIPLHKTSPNTSSNSNNNSNSDKAEALIDDRKKRRLFSNRESARRSRMRKKQQIEVLQYQVSQLQTLNYQLSQKIIYMLECNQQVQQQNAQLIEKVSSLQVTLSELFVVPVGHAEQSQHTLNSLLPENSTNC*
• ORF Type: complete

Annotations of Ll_transcript_41312

• Blastp: Basic leucine zipper 43 from Arabidopsis with 44.79% of identity
• Blastx: Basic leucine zipper 43 from Arabidopsis with 42.7% of identity
• Eggnog: Transcription factor(ENOG410YWTI)
• Kegg: Link to kegg annotations (AT5G38800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435645.1)
• Pfam: bZIP Maf transcription factor (PF03131.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;