Protein coding transcript 130237

• Transcript: Ll_transcript_41328
• CDS coordinates: 1-303 (-)
• Peptide sequence: DKDMVQKEMLLDVRVYKILMNCVARSGDVAAVSLLGNDMTQLSLMPENCVHSCMLKSFCLSGRIKESLELIRDLKSKGLDLEPESFETLVRGLCKESRITD
• ORF Type: internal

Annotations of Ll_transcript_41328

• Blastp: Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial from Arabidopsis with 43% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial from Arabidopsis with 43% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G06400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430431.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;