Protein coding transcript 130243

• Transcript: Ll_transcript_66691
• CDS coordinates: 3-368 (+)
• Peptide sequence: DDVGCADLWKFFKKWGRVRDVFIPLKRNRFNQRFAFIRFDKVRDEKSFASALDKVWFGNFKLFVNIPRFKRNVANISSPVDSSSGCPPTVPLKFRDSRSFVDAVKGVKGVNCVGSSLEPPVE
• ORF Type: internal

Annotations of Ll_transcript_66691

• Blastp: Serine/arginine-rich splicing factor 2 from Sus with 37.31% of identity
• Blastx: Serine/arginine-rich splicing factor 2 from Sus with 37.31% of identity
• Eggnog: serine arginine-rich splicing factor(ENOG4111NJ8)
• Kegg: Link to kegg annotations (768117)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228107.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;