Protein coding transcript 130244

• Transcript: Ll_transcript_66692
• CDS coordinates: 3-458 (+)
• Peptide sequence: SLFCTARRRTCDREFVINFRPAEHRRCEMSSKPAFKVADISLADWGRKEIILAENEMPGLMSLRRKYKDSKPLKGARIAGCLHMTVQTAVLIETLVVLGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTLVFKDGQ
• ORF Type: internal

Annotations of Ll_transcript_66692

• Blastp: Adenosylhomocysteinase from Caenorhabditis with 87.7% of identity
• Blastx: Adenosylhomocysteinase from Caenorhabditis with 87.7% of identity
• Eggnog: May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine (By similarity)(COG0499)
• Kegg: Link to kegg annotations (CELE_K02F2.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014519136.1)
• Pfam: S-adenosyl-L-homocysteine hydrolase (PF05221.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;