Transcript | Ll_transcript_66698 |
---|---|
CDS coordinates | 68-766 (+) |
Peptide sequence | MTPSVATFLNSFSNNLEEPVRVHLKNVYACLAMSTMAAAVGASVHLFTDILQAGFLTGIGSLVFFILLMSTPDDQGKNLKTRVGYLLGFTALSGVGMGPLLEHVILVNPSIIVTALVATSLVFISFSICAMLSQRGSWLYLGGTLMSMLMTLSVLSIANIFFGSTLLFQAQIYLGLFAMCGFVLYDTQMIIEKRRNGSRDFVSHSLDLFIDFIGIFKRLLIILTQKEQESQKK |
ORF Type | 3prime_partial |
Blastp | Probable Bax inhibitor 1 from Paralichthys with 50% of identity |
---|---|
Blastx | Bax inhibitor 1 from Homo with 47.89% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422063.1) |
Pfam | Inhibitor of apoptosis-promoting Bax1 (PF01027.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer