| Transcript | Ll_transcript_66694 |
|---|---|
| CDS coordinates | 2-487 (+) |
| Peptide sequence | NQWGMNQNNHLAMGGMGMGGPGGQMGGPMGGMGPMGPGNMMQGYQGGWSSTPQSQYPGYGTPSGPGGFQGWGAPPGPQGQGMAPPTWGSNYAPPQQPGYGSYAPQAPPQSSYGNNWNWNIPQNGPAAATGPPGQTGPGPQNDMYSRSAGAAPATGPTPPGTA |
| ORF Type | internal |
| Blastp | Heterogeneous nuclear ribonucleoprotein 27C from Sophophora with 52.17% of identity |
|---|---|
| Blastx | - |
| Eggnog | Rna-binding protein(ENOG410YA8Z) |
| Kegg | Link to kegg annotations (Dmel_CG10377) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421715.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer