Protein coding transcript 130250

• Transcript: Ll_transcript_36669
• CDS coordinates: 2-598 (+)
• Peptide sequence: FHSSQMAPTIKFIPLIFLLSLCFTTTIISREEEDCVYTVFIRTGSIFKGGTDSIIGLKLYDNFGWYIYIKNLESWGGLMEPGHNYFERGNLDIFSGRGACLDGPVCAVNVTSDGSGAHHGWYVNYVEVTSTGVHKTCAQKQFTLEQWVGTDVSPYQLWAQRDYCGNQTGLGLARSKTTVVDDVGSGSGYSILDLGVRV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_36669

• Blastp: PLAT domain-containing protein 2 from Arabidopsis with 57.5% of identity
• Blastx: PLAT domain-containing protein 2 from Arabidopsis with 57.5% of identity
• Eggnog: wound stress protein(ENOG410ZKR3)
• Kegg: Link to kegg annotations (AT2G22170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415958.1)
• Pfam: Embryo-specific protein 3, (ATS3) (PF06232.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;