Protein coding transcript 130251

• Transcript: Ll_transcript_66703
• CDS coordinates: 3-848 (+)
• Peptide sequence: VAVAQDNIEEIMSRFVVFVSMALTSVALAAPSQQNAAILTDARYLSNNGQFGAAYTQGDGVEFKEESDAAGNRRGSYSYVDPNGQRRTVSYTAGKDGFKATGDHLPVAPSPVAAPAAPAPKSGSWQQDQWSQAPAVPNQWNQAPAVPNQWNQWNAETTPKYDDGQWNQWSSDAEAAKSDDGQWNKWSSDAEAAKSDDGQWNQWSSESSNDGQWNQWNSAPSTAAPKHSQWNQWNSIPTTAKWNQWNSAPTPPPTSFNVNHASGKFNLNRSPDGFSYTFSQN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_66703

• Blastp: Adult-specific rigid cuticular protein 12.6 from Araneus with 60.78% of identity
• Blastx: Adult-specific rigid cuticular protein 12.6 from Araneus with 60.78% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003525130.1)
• Pfam: Insect cuticle protein (PF00379.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;