Protein coding transcript 130252

• Transcript: Ll_transcript_66676
• CDS coordinates: 2-346 (+)
• Peptide sequence: KLLNLRVPVVSLVQKCGLKHYQAPPKYDHVEFPEKPKLKYIDKVPQLPAAIKPPKMQKNLKLMRGPEPVHNFLLHKQYGIMALCGGRIKWGHFEMMRLTVGRKMDLNRMFAVWRI
• ORF Type: internal

Annotations of Ll_transcript_66676

• Blastp: 39S ribosomal protein L16, mitochondrial from Pongo with 41.74% of identity
• Blastx: 39S ribosomal protein L16, mitochondrial from Pongo with 41.74% of identity
• Eggnog: Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs (By similarity)(COG0197)
• Kegg: Link to kegg annotations (100173293)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003615299.1)
• Pfam: Ribosomal protein L16p/L10e (PF00252.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;