Protein coding transcript 130253

• Transcript: Ll_transcript_140234
• CDS coordinates: 3-1070 (+)
• Peptide sequence: LISIFLCTITIIKFKRLFTIIKYKRLFTITMKFKAFLTDNGVNLLEKRFLPALDKIGKTCHLYLTRDNAIFLHNLLNGDGVQSVAQFRIQALFDDYRISSQNDDRIAFTIDVSLLLRALRSTVSISSEYGADVAAPDSDSSNRLQIKLVKKLPPNCTVAMPFLTVETRGYKSAVIQDIPISKPLSRAQVVELQNALEMAQDLPQTLVQVPDLIQLQNFVDRMKNVGDVLNVFISKYGDLRVDVSTTLISLGAEFRKLLVIGEQANEPAEDQNLSARSRSSKSISRGDGQTVQVSVKHFSKSLQCHLSKPDCAFYGIAPQGSCLTMIFQFFIPGSRQSDKSISLHCRLPVLDPGSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_140234

• Blastp: Checkpoint protein hus1 homolog from Dictyostelium with 26.22% of identity
• Blastx: Checkpoint protein hus1 homolog from Dictyostelium with 26.04% of identity
• Eggnog: Checkpoint protein(ENOG410ZQ9J)
• Kegg: Link to kegg annotations (DDB_G0285353)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442697.1)
• Pfam: Hus1-like protein (PF04005.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;